missing translation for 'onlineSavingsMsg'
Learn More

Mkl1 Antibody, Novus Biologicals™

Product Code. 18238355 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18238355 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18238355 Supplier Novus Biologicals Supplier No. NBP180259

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Mkl1 Polyclonal specifically detects Mkl1 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Mkl1
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_694629
Gene Alias AMKL, KIAA1438, MALSAP and coiled-coil domain, megakaryoblastic leukemia (translocation) 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, MKL/myocardin-like protein 1, Myocardin-related transcription factor A, RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein
Gene Symbols MRTFA
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse. Peptide sequence QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57591
Test Specificity Expected identity based on immunogen sequence: Mouse: 100%; Rat: 100%; Bovine: 85%; Canine: 85%; Equine: 85%; Pig: 85%; Rabbit: 85%; Human: 78%; Chicken: 76%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.