Mkl1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80259

Product Code. 18238355

Description

Mkl1 Polyclonal specifically detects Mkl1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Mkl1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AMKL, KIAA1438, MALSAP and coiled-coil domain, megakaryoblastic leukemia (translocation) 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, MKL/myocardin-like protein 1, Myocardin-related transcription factor A, RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57591
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_694629
• Gene Symbols: MRTFA
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse. Peptide sequence QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Rat: 100%; Bovine: 85%; Canine: 85%; Equine: 85%; Pig: 85%; Rabbit: 85%; Human: 78%; Chicken: 76%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
• Form: Purified

For Research Use Only