MKK4/MEK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57194

Product Code. 18229774

Description

MKK4/MEK4 Polyclonal specifically detects MKK4/MEK4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MKK4/MEK4
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: c-Jun N-terminal kinase kinase 1, dual specificity mitogen-activated protein kinase kinase 4, JNK activating kinase 1, JNK-activated kinase 1, JNK-activating kinase 1, JNKK, JNKK1MAPK/ERK kinase 4, MAP kinase kinase 4, MAPKK4, MEK4MEK 4, mitogen-activated protein kinase kinase 4, MKK4SAPK/ERK kinase 1, PRKMK4MAPKK 4, SEK1, SERK1EC 2.7.12.2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MAP2K4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
• Quantity: 100 μL
• Research Discipline: Angiogenesis, Cancer, MAP Kinase Signaling, Protein Kinase, Signal Transduction, Tyrosine Kinases
• Gene ID (Entrez): 6416
• Target Species: Human
• Isotype: IgG

For Research Use Only