missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Mitochondrial Ribosomal Protein S18C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35846-20ul
This item is not returnable.
View return policy
Description
Mitochondrial Ribosomal Protein S18C Polyclonal antibody specifically detects Mitochondrial Ribosomal Protein S18C in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| Mitochondrial Ribosomal Protein S18C | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| 28S ribosomal protein S18c, mitochondrial, CGI-134, mitochondrial ribosomal protein S18-1, mitochondrial ribosomal protein S18C, MRP-S18-1, MRPS18-1, MRPS18-1mitochondrial, mrps18-c, MRP-S18-c, MRPS18C mitochondrial ribosomal protein S18C, S18mt-c | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human Mitochondrial Ribosomal Protein S18C (NP_057151.1).,, Sequence:, MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 51023 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction