missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Mitochondrial Ribosomal Protein S18C Antibody, Novus Biologicals™

Mitochondrial Ribosomal Protein S18C Antibody, Novus Biologicals™

Product Code. 30226789 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30226789 20 μL 20µL
30232670 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30226789 Supplier Novus Biologicals Supplier No. NBP33584620ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Mitochondrial Ribosomal Protein S18C Polyclonal antibody specifically detects Mitochondrial Ribosomal Protein S18C in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Mitochondrial Ribosomal Protein S18C
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias 28S ribosomal protein S18c, mitochondrial, CGI-134, mitochondrial ribosomal protein S18-1, mitochondrial ribosomal protein S18C, MRP-S18-1, MRPS18-1, MRPS18-1mitochondrial, mrps18-c, MRP-S18-c, MRPS18C mitochondrial ribosomal protein S18C, S18mt-c
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human Mitochondrial Ribosomal Protein S18C (NP_057151.1).,, Sequence:, MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51023
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.