Mitochondrial ribosomal protein L11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Code produit	Marque	Quantity
18476111	Novus Biologicals NBP2-33844-25ul	25 μL
18183082	Novus Biologicals NBP2-33844	0.1 mL

Description

Mitochondrial ribosomal protein L11 Polyclonal specifically detects Mitochondrial ribosomal protein L11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spécification

• Antigen: Mitochondrial ribosomal protein L11
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q9Y3B7
• Gene ID (Entrez): 65003
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: L11MT, MGC111024, mitochondrial ribosomal protein L11, MRP-L11,39S ribosomal protein L11, mitochondrial
• Gene Symbols: MRPL11
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only