MiRP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18465890	Novus Biologicals NBP1-83238-25ul	25 μL
18243017	Novus Biologicals NBP1-83238	0.1 mL

Description

MiRP2 Polyclonal specifically detects MiRP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MiRP2
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10008
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: cardiac voltage-gated potassium channel accessory subunit, DKFZp781H21101, HOKPPMGC102685, HYPP, MGC129924, Minimum potassium ion channel-related peptide 2, MinK-related peptide 2, MiRP2, Potassium channel subunit beta MiRP2, potassium voltage-gated channel subfamily E member 3, potassium voltage-gated channel, Isk-related family, member 3, voltage-gated K+ channel subunit MIRP2
• Gene Symbols: KCNE3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only