missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MINDY4B/FAM188B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

MINDY4B/FAM188B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18359295 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18359295 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18359295 Supplier Novus Biologicals Supplier No. NBP318693100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MINDY4B/FAM188B2 Polyclonal antibody specifically detects MINDY4B/FAM188B2 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MINDY4B/FAM188B2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Formulation 1x PBS in 2% sucrose
Gene Alias C3orf76, epididymis secretory sperm binding protein, FAM188B2, family with sequence similarity 188 member B2, inactive ubiquitin carboxyl-terminal hydrolase MINDY-4B, protein FAM188B2, Putative UPF0526 protein B
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MINDY4B/FAM188B2 (LOC646951): SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 646951
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.