missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MIER1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35857-100ul
This item is not returnable.
View return policy
Description
MIER1 Polyclonal antibody specifically detects MIER1 in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| MIER1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZp781G0451, Early response 1, ER1, hMI-ER1, KIAA1610MI-ER1, mesoderm induction early response 1 (MI-ER1), mesoderm induction early response 1 homolog (Xenopus laevis), mesoderm induction early response protein 1, MGC131940, MGC150640, MGC150641, Mi-er1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 110-160 of human MIER1 (Q8N108).,, Sequence:, SGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNS | |
| 100 μL | |
| Cell Cycle and Replication | |
| 57708 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction