missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MICAL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38153
This item is not returnable.
View return policy
Description
MICAL1 Polyclonal specifically detects MICAL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MICAL1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q8TDZ2 | |
| MICAL1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VLFLSKLQRTLQRSRAKENAEDAGGKKLRLEMEAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALCGEHLYVLER | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CasL interacting molecule, DKFZp434B1517, FLJ11937, FLJ21739, MICALMolecule interacting with CasL protein 1, microtubule associated monoxygenase, calponin and LIM domain containing 1, NEDD9 interacting protein with calponin homology and LIM domains, NEDD9-interacting protein with calponin homology and LIM domains, NICALMICAL-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 64780 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction