missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MHC Class I Monoclonal antibody specifically detects MHC Class I in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | MHC Class I |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 3I1C1 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | DKFZp686P19218, EA1.2, EA2.1, HLA class I histocompatibility antigen, alpha chain E, HLA class I histocompatibility antigen, E alpha chain, HLA-6.2, HLAE, lymphocyte antigen, major histocompatibility complex, class I, E, MHC, MHC class I antigen E, MHC HLA-E alpha-1, MHC HLA-E alpha-2.1, QA1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MHC Class I (P04439). KETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?