missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MGAT4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £484.00
Specifications
| Antigen | MGAT4B |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18471831
|
Novus Biologicals
NBP2-14236-25ul |
25ul |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18061099
|
Novus Biologicals
NBP2-14236 |
0.1 mL |
£484.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MGAT4B Polyclonal specifically detects MGAT4B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MGAT4B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, aminyltransferase, EC 2.4.1.145, GlcNAc-T IVb, GNT-IV, GNT-IVB, isoenzyme B, isozyme B, mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, N-acetylglucosaminyltransferase IVb, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IV, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IVb | |
| MGAT4B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 11282 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title