missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MGAT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62441
This item is not returnable.
View return policy
Description
MGAT2 Polyclonal specifically detects MGAT2 in Human samples. It is validated for Western Blot.
Specifications
| MGAT2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase, Beta-1,2-N-acetylglucosaminyltransferase II, CDG2A, EC 2.4.1.143, GlcNAc-T II, GLCNACTII, GNT2, GNT-IICDGS2, Mannoside acetylglucosaminyltransferase 2, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II, UDP-N-acetylglucosamine:alpha-6-D-mannosidebeta-1,2-N-acetylglucosaminyltransferase II | |
| Rabbit | |
| 51 kDa | |
| 100 μL | |
| metabolism, Proteases & Other Enzymes | |
| 4247 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q10469 | |
| MGAT2 | |
| Synthetic peptides corresponding to MGAT2(mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase) The peptide sequence was selected from the middle region of MGAT2. Peptide sequence YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction