MFSD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18469661	Novus Biologicals NBP1-92114-25ul	25 μL

Description

MFSD8 Polyclonal specifically detects MFSD8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MFSD8
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 256471
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: ceroid-lipofuscinosis, neuronal 7, late infantile, variant, CLN7, major facilitator superfamily domain containing 8, major facilitator superfamily domain-containing protein 8, MGC33302neuronal 7, late infantile
• Gene Symbols: MFSD8
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only