missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MFSD8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | MFSD8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MFSD8 Polyclonal specifically detects MFSD8 in Human samples. It is validated for Western Blot.Specifications
| MFSD8 | |
| Polyclonal | |
| Rabbit | |
| NP_689991 | |
| 256471 | |
| Synthetic peptide directed towards the middle region of human MFSD8The immunogen for this antibody is MFSD8. Peptide sequence FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ceroid-lipofuscinosis, neuronal 7, late infantile, variant, CLN7, major facilitator superfamily domain containing 8, major facilitator superfamily domain-containing protein 8, MGC33302neuronal 7, late infantile | |
| MFSD8 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title