missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MFNG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MFNG |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MFNG Polyclonal specifically detects MFNG in Human samples. It is validated for Western Blot.Specifications
| MFNG | |
| Polyclonal | |
| Rabbit | |
| NP_002396 | |
| 4242 | |
| Synthetic peptide directed towards the C terminal of human MFNG. Peptide sequence QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| beta-1,3-N-acetylglucosaminyltransferase manic fringe, EC 2.4.1.222, manic fringe (Drosophila) homolog, manic fringe homolog (Drosophila), MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase | |
| MFNG | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title