missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Methyltransferase like 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Methyltransferase like 5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Methyltransferase like 5 Polyclonal specifically detects Methyltransferase like 5 in Human samples. It is validated for Western Blot.Specifications
| Methyltransferase like 5 | |
| Polyclonal | |
| Rabbit | |
| Q9NRN9 | |
| 29081 | |
| Synthetic peptides corresponding to METTL5(methyltransferase like 5) The peptide sequence was selected from the N terminal of METTL5. Peptide sequence KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.1.1.-, FLJ10459, HSPC133, methyltransferase like 5, methyltransferase-like protein 5 | |
| METTL5 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title