Methyltransferase Like 24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-90566-25ul

Produktkod. 18451972

Beskrivning

Methyltransferase Like 24 Polyclonal specifically detects Methyltransferase Like 24 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifikationer

• Antigen: C6orf186
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C6orf186, chromosome 6 open reading frame 186, dJ71D21.2, methyltransferase like 24, UPF0624 protein C6orf186
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 728464
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: METTL24
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AQSLDEEAWRFLRYISTTQIACNHMNTDSLATDSSPTHKPWSVCLDDRFNLAHQIRNKQCRLYSLGLGSDDTHFEVSMANNGCEV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only