Methionyl tRNA synthetase 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18466771	Novus Biologicals NBP2-34013-25ul	25 μL
18169053	Novus Biologicals NBP2-34013	0.1 mL

Description

Methionyl tRNA synthetase 2 Polyclonal specifically detects Methionyl tRNA synthetase 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Methionyl tRNA synthetase 2
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 6.1.1, EC 6.1.1.10, methionine tRNA ligase 2, mitochondrial, methionine-tRNA ligase, Methionine--tRNA ligase 2, methionine-tRNA synthetase 2 (mitochondrial), methionine-tRNA synthetase 2, mitochondrial, methionyl-tRNA synthetase 2, mitochondrial, methionyl-tRNA synthetase, mitochondrial, MetRS, Mitochondrial methionine--tRNA ligase, mitochondrial methionyl-tRNA synthetase, mtMetRS
• Gene Symbols: MARS2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q96GW9
• Gene ID (Entrez): 92935
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLNSELADALGGLLNRCTAKRINPSETYPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only