missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18364969

Methionine Sulfoxide Reductase B Antibody, Novus Biologicals™

Product Code. 18364969 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.10mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18364969 0.1 mg 0.10mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18364969 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' H00051734D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Methionine Sulfoxide Reductase B Polyclonal antibody specifically detects Methionine Sulfoxide Reductase B in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Methionine Sulfoxide Reductase B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_057416.1
Gene Alias EC 1.8.4.-, methionine sulfoxide reductase, methionine-R-sulfoxide reductase B1, MGC3344, MsrB1, MSRB1selenoprotein R, Selenoprotein X, selenoprotein X, 1, SELR, SelX
Host Species Rabbit
Immunogen SEPX1 (NP_057416.1, 1 a.a. - 94 a.a.) full-length human protein. MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRF
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Amino Acids Drugs and other small molecules, Cancer, Cell Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51734
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.