Methionine Sulfoxide Reductase A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17739-100UL

Product Code. 18373314

Description

Methionine Sulfoxide Reductase A Polyclonal antibody specifically detects Methionine Sulfoxide Reductase A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Methionine Sulfoxide Reductase A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSTIYPTS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4482
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG