Methionine Aminopeptidase 1D/MAP1D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18406871	Novus Biologicals NBP1-92098-25ul	25 μL

Description

Methionine Aminopeptidase 1D/MAP1D Polyclonal specifically detects Methionine Aminopeptidase 1D/MAP1D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Methionine Aminopeptidase 1D/MAP1D
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 3.4.11.18, MAP1DCDS of metAP-3 within PCR fragment, Metap1l, methionine aminopeptidase 1D, mitochondrial, methionyl aminopeptidase type 1D (mitochondrial), Methionyl aminopeptidase type 1D, mitochondrial
• Gene Symbols: METAP1D
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Immunology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 254042
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGG
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only