missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MESP2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

MESP2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18334014 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18334014 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Produktkod. 18334014 Leverantör Novus Biologicals Leverantörsnummer NBP310989100UL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

MESP2 Polyclonal specifically detects MESP2 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen MESP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias bHLHc6, class C basic helix-loop-helix protein 6, mesoderm posterior 2 homolog (mouse), mesoderm posterior protein 2, SCDO2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse MESP2 (NP_032615.2). Peptide sequence RRTRPAPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVAPAGQSLTK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 145873
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.