missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Mesothelin Monoclonal antibody specifically detects Mesothelin in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
Specifications
Specifications
| Antigen | Mesothelin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 5R9H8 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | CAK1, CAK1 antigen, megakaryocyte potentiating factor, mesothelin, MPFSMRP, Pre-pro-megakaryocyte-potentiating factor, soluble MPF mesothelin related protein |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Mesothelin (Q13421). YFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?