missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MERIT40/HSPC142 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58126
This item is not returnable.
View return policy
Description
MERIT40/HSPC142 Polyclonal specifically detects MERIT40/HSPC142 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| MERIT40/HSPC142 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| BRISC and BRCA1 A complex member 1, C10orf62, C19orf62, chromosome 19 open reading frame 62, FLJ20571, HSPC142, mediator of Rap80 interactions and targeting 40 kDa, Mediator of RAP80 interactions and targeting subunit of 40 kDa, MERIT40BRCA1-A complex subunit MERIT40, NBA1BRISC and BRCA1 A complex member, new component of the BRCA1 A complex, New component of the BRCA1-A complex, new component of the BRCAA1 A complex | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| BABAM1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing | |
| 29086 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction