missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18326789

Melusin/ITGB1BP2 Antibody (3G9), Novus Biologicals™

Product Code. 18326789 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18326789 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18326789 Supplier Novus Biologicals Supplier No. H00026548M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Melusin/ITGB1BP2 Monoclonal antibody specifically detects Melusin/ITGB1BP2 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Melusin/ITGB1BP2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 3G9
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_036410
Gene Alias CHORDC3, integrin beta 1 binding protein (melusin) 2, integrin beta-1-binding protein 2, ITGB1BP, Melusin, MGC119214
Host Species Mouse
Immunogen ITGB1BP2 (NP_036410, 246 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Cellular Markers, Cytokine Research, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 26548
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.