Melanoma antigen family C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-68961

Product Code. 18284102

Description

Melanoma antigen family C2 Polyclonal specifically detects Melanoma antigen family C2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Melanoma antigen family C2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cancer/testis antigen 10, CT10MAGE-E1 antigen, HCA587MAGE-C2, hepatocellular cancer antigen 587, Hepatocellular carcinoma-associated antigen 587, MAGE-C2 antigen, MAGEE1MGC13377, melanoma antigen family C, 2, melanoma antigen, family E, 1, cancer/testis specific, melanoma-associated antigen C2
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UBF1
• Gene Symbols: MAGEC2
• Immunogen: Synthetic peptides corresponding to MAGEC2 (melanoma antigen family C, 2) The peptide sequence was selected from the N terminal of MAGEC2. Peptide sequence SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51438
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.