missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Melanoma Antigen Family B16 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Melanoma Antigen Family B16 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18357362 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18357362 25 μg 25µL
18375832 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18357362 Supplier Novus Biologicals Supplier No. NBP31716725UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Melanoma Antigen Family B16 Polyclonal antibody specifically detects Melanoma Antigen Family B16 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Melanoma Antigen Family B16
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias MAGEB16, MAGE-B16 Antigen, Melanoma Antigen Family B, 16, Melanoma Antigen Family B, 16 (Pseudogene), Melanoma-Associated Antigen B16
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SEDTSDPRNVPADALDQKVAFLVNFMLHKCQMK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 139604
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.