MEKK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18487981	Novus Biologicals NBP2-34004-25ul	25 μL
18106252	Novus Biologicals NBP2-34004	0.1 mL

Description

MEKK3 Polyclonal specifically detects MEKK3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MEKK3
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q99759
• Gene ID (Entrez): 4215
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Angiogenesis, Cancer, Immunology, Innate Immunity, Protein Kinase
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7.11.25, MAP/ERK kinase kinase 3, MAPK/ERK kinase kinase 3, MAPKKK3MEKK 3, MEK kinase 3, MEKK3, mitogen-activated protein kinase kinase kinase 3
• Gene Symbols: MAP3K3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only