missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MEKK1 Antibody (2F6) - Azide and BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
£464.00
Specifications
| Antigen | MEKK1 |
|---|---|
| Clone | 2F6 |
| Concentration | 1.0 mg/mL |
| Dilution | Western Blot : 0.5 - 1.0 ug/ml, Flow Cytometry : 0.5 - 1 ug/million cells in 0.1 ml, Immunohistochemistry-Paraffin : 0.5 - 1.0 ug/ml, Immunofluorescence : 1 - 2 ug/ml, CyTOF-ready |
| Applications | Western Blot, Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence, CyTOF |
Description
MEKK1 Monoclonal specifically detects MEKK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MEKK1 | |
| 1.0 mg/mL | |
| Western Blot, Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence, CyTOF | |
| Unconjugated | |
| Mouse | |
| Angiogenesis, Breast Cancer, Cancer, Lipid and Metabolism, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
| PBS with No Preservative | |
| 4214 | |
| Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 2F6 | |
| Western Blot : 0.5 - 1.0 ug/ml, Flow Cytometry : 0.5 - 1 ug/million cells in 0.1 ml, Immunohistochemistry-Paraffin : 0.5 - 1.0 ug/ml, Immunofluorescence : 1 - 2 ug/ml, CyTOF-ready | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1 | |
| MAP3K1 | |
| IgG2a κ | |
| Protein A or G purified | |
| Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title