missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MEK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38660-25ul
This item is not returnable.
View return policy
Description
MEK2 Polyclonal specifically detects MEK2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| MEK2 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P36507 | |
| MAP2K2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL | |
| 25 μL | |
| Angiogenesis, Autophagy, Cancer, MAP Kinase Signaling, Protein Kinase, Protein Phosphatase, Signal Transduction | |
| 5605 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ERK activator kinase 2, MAPKK 2, MEK 2, MEK2EC 2.7.12.2, mitogen-activated protein kinase kinase 2, MKK2FLJ26075, p45, PRKMK2MAPKK2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction