missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57915
This item is not returnable.
View return policy
Description
MED7 Polyclonal specifically detects MED7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| MED7 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| Activator-recruited cofactor 34 kDa component, Cofactor required for Sp1 transcriptional activation subunit 9, cofactor required for Sp1 transcriptional activation, subunit 9 (33kD), cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa, CRSP33CRSP complex subunit 9, CRSP9hMED7, mediator complex subunit 7ARC34, mediator of RNA polymerase II transcription subunit 7, MGC12284, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MED7 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing | |
| 9443 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction