MED6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38118

Product Code. 18131888

Description

MED6 Polyclonal specifically detects MED6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MED6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: O75586
• Gene Symbols: MED6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Activator-recruited cofactor 33 kDa component, ARC33, mediator complex subunit 6hMed6, mediator of RNA polymerase II transcription subunit 6, mediator of RNA polymerase II transcription, subunit 6 homolog, mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae), NY-REN-28, Renal carcinoma antigen NY-REN-28
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10001
• Target Species: Human
• Isotype: IgG