MED27 Antibody (8B8), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00009442-M01

Product Code. 18369828

Description

MED27 Monoclonal antibody specifically detects MED27 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA

Specifications

• Antigen: MED27
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa, CRSP34CRSP complex subunit 8, CRSP8CRAP34, mediator complex subunit 27Transcriptional coactivator CRSP34, mediator of RNA polymerase II transcription subunit 27, MGC11274, P37 TRAP/SMCC/PC2 subunit, subunit 8 (34kD), TRAP37
• Immunogen: CRSP8 (AAH02878, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
• Quantity: 0.05 mg
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 9442
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG1 κ

• Applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
• Clone: 8B8
• Dilution: Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA
• Gene Accession No.: AAH02878
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified