missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MED26 Polyclonal specifically detects MED26 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | MED26 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MED26 (NP_004822). Peptide sequence TAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEET |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?