missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37894-20ul
This item is not returnable.
View return policy
Description
MED26 Polyclonal antibody specifically detects MED26 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| MED26 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 500-574 of human MED26 (NP_004822.2).,, Sequence:, SGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWY | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 9441 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction