missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56372-25ul
This item is not returnable.
View return policy
Description
MED23 Polyclonal specifically detects MED23 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| MED23 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| 130 kDa transcriptional co-activator, 133 kDa transcriptional co-activator, CRSP130, DRIP130DKFZp434H0117, mediator complex subunit 23CRSP133, Protein sur-2 homolog, subunit 3, 130kDa, Transcriptional coactivator CRSP130, Vitamin D3 receptor-interacting protein complex 130 kDa component | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MED23 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG | |
| 25 μL | |
| Cell Biology, Signal Transduction, Transcription Factors and Regulators | |
| 9439 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction