MED18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18446310	Novus Biologicals NBP1-83673-25ul	25 μL
18294456	Novus Biologicals NBP1-83673	0.1 mL

Description

MED18 Polyclonal specifically detects MED18 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MED18
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 54797
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGH
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: FLJ20045, mediator complex subunit 18mediator of RNA polymerase II transcription subunit 18, mediator of RNA polymerase II transcription, subunit 18 homolog (S. cerevisiae), p28bmediator of RNA polymerase II transcription, subunit 18 homolog, TRAP/mediator complex subunit p28b
• Gene Symbols: MED18
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only