missing translation for 'onlineSavingsMsg'
Learn More

MED17 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18379946 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18379946 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18379946 Supplier Novus Biologicals Supplier No. NBP310313100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

MED17 Polyclonal specifically detects MED17 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MED17
Applications ChIP Assay, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS buffer, 2% sucrose
Gene Alias Activator-recruited cofactor 77 kDa component, Cofactor required for Sp1 transcriptional activation subunit 6, cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa, CRSP6FLJ10812, CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD), DRIP77, DRIP80ARC77, mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component, mediator of RNA polymerase II transcription subunit 17, Thyroid hormone receptor-associated protein complex 80 kDa component, Transcriptional coactivator CRSP77, Trap80, TRAP80CRSP complex subunit 6
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MED17 (NP_004259). Peptide sequence AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9440
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.