missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MED17 Polyclonal specifically detects MED17 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | MED17 |
| Applications | ChIP Assay, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Activator-recruited cofactor 77 kDa component, Cofactor required for Sp1 transcriptional activation subunit 6, cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa, CRSP6FLJ10812, CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD), DRIP77, DRIP80ARC77, mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component, mediator of RNA polymerase II transcription subunit 17, Thyroid hormone receptor-associated protein complex 80 kDa component, Transcriptional coactivator CRSP77, Trap80, TRAP80CRSP complex subunit 6 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MED17 (NP_004259). Peptide sequence AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?