missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAD2L1-binding protein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55414-25ul
This item is not returnable.
View return policy
Description
MAD2L1-binding protein Polyclonal specifically detects MAD2L1-binding protein in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| MAD2L1-binding protein | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| Caught by MAD2 protein, CMT2MGC11282, dJ261G23.1, KIAA0110RP1-261G23.6, MAD2L1 binding protein, MAD2L1-binding protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MAD2L1BP | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQLPLPY | |
| 25 μL | |
| Cell Cycle and Replication | |
| 9587 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction