missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | MED13 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18243403
|
Novus Biologicals
NBP2-57545 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18673369
|
Novus Biologicals
NBP2-57545-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MED13 Polyclonal specifically detects MED13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| MED13 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Activator-recruited cofactor 250 kDa component, KIAA0593HSPC221, mediator complex subunit 13ARC250, mediator of RNA polymerase II transcription, subunit 13 homolog, THRAP1mediator of RNA polymerase II transcription subunit 13, thyroid hormone receptor associated protein 1, Thyroid hormone receptor-associated protein 1, Thyroid hormone receptor-associated protein complex 240 kDa component, thyroid hormone receptor-associated protein complex component TRAP240, thyroid hormone receptor-associated protein, 240 kDa subunit, Trap240, TRAP240DRIP250, Vitamin D3 receptor-interacting protein complex component DRIP250 | |
| MED13 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9969 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title