MED10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58707-25ul

Product Code. 18689526

Description

MED10 Polyclonal specifically detects MED10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MED10
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: L6, mediator complex subunit 10TRG-17, mediator of RNA polymerase II transcription subunit 10, mediator of RNA polymerase II transcription, subunit 10, mediator of RNA polymerase II transcription, subunit 10 homolog (NUT2, S.cerevisiae), MGC5309, NUT2TRG-20, Transformation-related gene 17 protein, Transformation-related gene 20 protein, TRG20
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84246
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MED10
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only