missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MDL-1/CLEC5A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | MDL-1/CLEC5A |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18667826
|
Novus Biologicals
NBP2-68708-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661768
|
Novus Biologicals
NBP2-68708 |
100 μg |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MDL-1/CLEC5A Polyclonal antibody specifically detects MDL-1/CLEC5A in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| MDL-1/CLEC5A | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 23601 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CLECSF5carbohydrate-recognition domain) lectin, superfamilymember 5, C-type lectin domain family 5, member A, C-type lectin superfamily member 5, MDL-1MGC138304, Myeloid DAP12-associating lectin 1, myeloid DAP12-associating lectin-1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title