missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MCMDC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C8orf45 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MCMDC2 Polyclonal specifically detects MCMDC2 in Human samples. It is validated for Western Blot.Specifications
| C8orf45 | |
| Polyclonal | |
| Rabbit | |
| C8orf45, chromosome 8 open reading frame 45, FLJ25692, minichromosome maintenance complex component-like, minichromosome maintenance domain containing 2 | |
| MCMDC2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 157777 | |
| Synthetic peptides corresponding to C8orf45 (chromosome 8 open reading frame 45) The peptide sequence was selected from the middle region of C8orf45. Peptide sequence IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title