missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MCM6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58075
This item is not returnable.
View return policy
Description
MCM6 Polyclonal specifically detects MCM6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MCM6 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DNA replication licensing factor MCM6, EC 3.6.4.12, MCG40308, MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe), MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S.cerevisiae), minichromosome maintenance complex component 6, minichromosome maintenance deficient (mis5, S. pombe) 6, minichromosome maintenance deficient 6 homolog, minichromosome maintenance deficient 6 homolog (S. cerevisiae), Mis5, MIS5 homolog, p105MCM | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q14566 | |
| MCM6 | |
| Synthetic peptides corresponding to MCM6(minichromosome maintenance complex component 6) The peptide sequence was selected from the C terminal of MCM6. Peptide sequence RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE. | |
| 100 μL | |
| Cell Cycle and Replication, DNA Repair | |
| 4175 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction