missing translation for 'onlineSavingsMsg'
Learn More

MCM3 Antibody (3E11), Novus Biologicals™

Product Code. 18359097 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18359097 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18359097 Supplier Novus Biologicals Supplier No. H00004172M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

MCM3 Monoclonal antibody specifically detects MCM3 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen MCM3
Applications Western Blot, ELISA
Classification Monoclonal
Clone 3E11
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002379
Gene Alias cervical cancer proto-oncogene 5, DNA polymerase alpha holoenzyme-associated protein P1, DNA replication factor MCM3, DNA replication licensing factor MCM3, EC 3.6.4.12, HCC5, hRlf beta subunit, MCM3 minichromosome maintenance deficient 3, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), MGC1157, minichromosome maintenance complex component 3, minichromosome maintenance deficient (S. cerevisiae) 3, minichromosome maintenance deficient 3, P1.h, p102, P1-MCM3, replication licensing factor, beta subunit, RLF subunit beta, RLFB
Host Species Mouse
Immunogen MCM3 (NP_002379, 26 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4172
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.