missing translation for 'onlineSavingsMsg'
Learn More

MCAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£222.00 - £470.00

Specifications

Antigen	MCAT
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18263944 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-58354	100 μL	£470.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18683577 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-58354-25ul	25 μL	£222.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

MCAT Polyclonal specifically detects MCAT in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	MCAT
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	27349
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	EC 2.3.1.39, fabD, FASN2C, malonyl CoA:ACP acyltransferase (mitochondrial), malonyl-CoA:acyl carrier protein transacylase, mitochondrial, malonyl-CoA-acyl carrier protein transacylase, mitochondrial, MCT[Acyl-carrier-protein] malonyltransferase, Mitochondrial malonyltransferase, MTMGC47838, NET62
Gene Symbols	MCAT
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Cancelar Enviar

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado

MCAT Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents