missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MBP Antibody (CL2829), Novus Biologicals™

MBP Antibody (CL2829), Novus Biologicals™

Product Code. 18659605 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18659605 25 μL 25µL
18634536 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18659605 Supplier Novus Biologicals Supplier No. NBP24663225ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

MBP Monoclonal antibody specifically detects MBP in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen MBP
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL2829
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, ELISA, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein
Host Species Mouse
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Hypoxia Signaling, Immune System Diseases, Immunology, Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4155
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.