missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MBP Monoclonal antibody specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
Specifications
Specifications
| Antigen | MBP |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 7D2 |
| Conjugate | Janelia Fluor 646 |
| Dilution | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Formulation | 50mM Sodium Borate |
| Gene Alias | MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein |
| Host Species | Mouse |
| Immunogen | Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?