missing translation for 'onlineSavingsMsg'
Learn More

MBP Antibody (7D2), DyLight 488, Novus Biologicals™

Product Code. 18425918 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18425918 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18425918 Supplier Novus Biologicals Supplier No. NBP105204G

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

MBP Monoclonal antibody specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen MBP
Applications Western Blot, Immunohistochemistry, Immunofluorescence
Classification Monoclonal
Clone 7D2
Conjugate DyLight 488
Dilution Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Formulation 50mM Sodium Borate
Gene Alias MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein
Host Species Mouse
Immunogen Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Hypoxia Signaling, Immune System Diseases, Immunology, Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Phospho Specific, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4155
Target Species Human, Mouse, Rat, Pig, Bovine, Equine
Content And Storage Store at 4°C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.