MBD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10031-100UL

Product Code. 18337215

Description

MBD4 Polyclonal specifically detects MBD4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MBD4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MBD4 (NP_001263199.1). Peptide sequence TSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSK
• Quantity: 100 μg
• Research Discipline: Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics
• Gene ID (Entrez): 8930
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified