MAVS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38704-25ul

Product Code. 18668585

Description

MAVS Polyclonal specifically detects MAVS in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MAVS
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q7Z434
• Gene Symbols: MAVS
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK
• Quantity: 25 μL
• Research Discipline: Immune Dysfunction, Immune System Diseases, Immunology, Protein Kinase
• Gene ID (Entrez): 57506
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CARD adapter inducing interferon beta, CARD adapter inducing interferon-beta, CARD adaptor inducing IFN-beta, CARDIF, DKFZp547C224, DKFZp666M015, FLJ27482, IFN-B promoter stimulator 1, Interferon beta promoter stimulator protein 1, interferon-beta promoter stimulator protein 1, IPS-1FLJ41962, IPS1MGC3260, KIAA1271FLJ35386, mitochondrial antiviral signaling protein, mitochondrial antiviral-signaling protein, mitochondrial viral signaling protein, Putative NF-kappa-B-activating protein 031N, virus-induced signaling adapter variant 1b, virus-induced signaling adaptor variant 1a, Virus-induced-signaling adapter, VISAFLJ38051
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.